Cat: IPD-X12732

Recombinant Human IGFBP-7 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFBP-7

  • 简介

    IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Insulin-like growth factor-binding protein 7; IGFBP7; IGF-binding protein 7; IGFBP-rP1; MAC25 protein; Tumor-derived adhesion factor; TAF

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16270-1

  • Expression Region

    S27-L282

  • AA Sequence

    SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    30-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Insulin-like Growth Factor Binding Protein-7 (IGFBP-7) is a member of the IGFBP family, which plays a crucial role in regulating the bioavailability of insulin-like growth factors (IGFs) that are pivotal in cellular growth, differentiation, and metabolism. Research has indicated that IGFBP-7 exhibits multifaceted functions beyond its binding abilities, such as modulating apoptosis, playing a role in tumorigenesis, and influencing tissue repair processes. Elevated levels of IGFBP-7 have been implicated in various pathological conditions, including cancer, cardiovascular diseases, and metabolic disorders. The recombinant production of IGFBP-7 has been explored to elucidate its biological functions and therapeutic potential. By generating pure IGFBP-7 protein, researchers aim to investigate its effects on cellular pathways and its potential as a biomarker for disease prognosis or as a target for novel therapeutic strategies. Moreover, understanding the structure-function relationship of IGFBP-7 can facilitate the development of IGFBP-7-based drugs or therapies, highlighting its significance in both fundamental and clinical research. The ongoing studies into IGFBP-7's mechanisms of action continue to unravel its potential roles in health and disease, making it a compelling subject of investigation in the fields of endocrinology, oncology, and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US