Analytical Data
-
Gene name
PPP1Cb
- Application
-
Alternative Names
PPP1Cb；Serine/threonine-Protein phosphatase PP1-beta catalytic subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62140
-
Expression Region
2-327aa
-
AA Sequence
ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
-
Molecular Weight
41.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1Cb, or Protein Phosphatase 1 Catalytic Subunit Beta, is a critical enzyme in the regulation of various cellular processes, including cell division, metabolism, and signal transduction. As a member of the PPP family, PPP1Cb is involved in dephosphorylating serine and threonine residues, which is a fundamental post-translational modification influencing protein activity and stability. Dysregulation of PPP1Cb has been implicated in numerous diseases, including cancer, cardiac disorders, and neurodegenerative conditions. Therefore, understanding the functional mechanisms of PPP1Cb is essential for developing therapeutic strategies. Research on recombinant PPP1Cb proteins facilitates the exploration of structure-function relationships, substrate specificity, and interaction with regulatory proteins. The expression and purification of recombinant PPP1Cb enable in vitro studies that can elucidate the role of this phosphatase in cellular signaling pathways and disease mechanisms. These studies contribute to our knowledge of PPP1Cb's potential as a biomarker or a therapeutic target in diverse pathological contexts.
