Analytical Data
-
Gene name
TPSAB1
- Application
-
Alternative Names
TPSAB1；TPS1；Tryptase alpha/beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15661
-
Expression Region
31-275aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMIVGGQEAPRSKWPWQVSLRVHGPYW MHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVS RIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPC WVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIV RDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPG IYTRVTYYLDWIHHYVPKKP
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPSAB1, or Tryptase Beta 1, is a serine protease predominantly expressed in mast cells and plays a crucial role in various physiological and pathological processes, including inflammation, allergic responses, and tissue remodeling. Research into TPSAB1 has gained significant interest due to its involvement in the pathogenesis of various diseases, such as asthma, chronic rhinosinusitis, and certain autoimmune conditions. Abnormal expression or activity of TPSAB1 has been linked to increased mast cell degranulation, leading to the release of pro-inflammatory cytokines and other mediators. This has prompted investigations into the potential of TPSAB1 as a therapeutic target for controlling allergic reactions and other mast cell-related disorders. Additionally, the development of recombinant forms of TPSAB1 allows for in-depth study of its biological functions and interactions, facilitating the discovery of inhibitors that could mitigate its detrimental effects in disease contexts. Understanding the molecular mechanisms governing TPSAB1 activity may pave the way for novel treatment approaches aimed at modulating mast cell function and improving patient outcomes in allergic and inflammatory diseases.
