Analytical Data
-
Gene name
ARHGAP25
- Application
-
Alternative Names
ARHGAP 25; ARHGAP25; Epididymis secretory Protein Li 308; HEL S 308
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42331
-
Expression Region
1-458aa
-
AA Sequence
MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL
-
Molecular Weight
78.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARHGAP25, a member of the Rho GTPase-activating protein (RhoGAP) family, has garnered significant attention in cellular and molecular biology due to its role in regulating Rho family GTPases, which are critical mediators of various cellular processes including cytoskeletal dynamics, cell migration, and proliferation. Research indicates that ARHGAP25 influences actin cytoskeleton remodeling and is involved in the regulation of cell adhesion, making it an important player in developmental biology and cancer metastasis. In recent studies, ARHGAP25 has been identified as a potential tumor suppressor, as its downregulation is often associated with increased cancer cell invasiveness and poor clinical outcomes. This has spurred interest in the therapeutic potential of targeting ARHGAP25 pathways in cancer treatment. Additionally, the structural and functional characterization of ARHGAP25 through recombinant protein studies is essential for understanding its mechanistic roles at the molecular level, providing insights into how it interacts with Rho GTPases and other cellular partners. Overall, research on ARHGAP25's recombinant protein is critical for elucidating its functions in health and disease, paving the way for novel therapeutic strategies that exploit its regulatory capabilities in cellular signaling pathways.
