Analytical Data
-
Gene name
TNFRSF9
- Application
-
Alternative Names
TNFRSF9;TRAP3;TNF receptor-associated factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07011
-
Expression Region
24-186aa
-
AA Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQ
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF9, also known as 4-1BB (CD137), is a member of the tumor necrosis factor receptor superfamily and plays a pivotal role in regulating immune responses, particularly in T cell activation, survival, and proliferation. Its engagement has been found to enhance anti-tumor immunity, making it a promising target for cancer immunotherapy. Research has shown that recombinant proteins of TNFRSF9 can significantly stimulate T cell responses, potentially improving the efficacy of cancer treatments. Additionally, due to its expression on activated T cells and natural killer (NK) cells, TNFRSF9 can serve as a valuable biomarker for immune activation. Studies are increasingly focused on the development and optimization of TNFRSF9-based therapies, including agonistic antibodies and fusion proteins, which aim to harness the receptor’s immune-enhancing properties while minimizing adverse effects. The growing understanding of the molecular mechanisms underlying TNFRSF9 signaling pathways provides opportunities for novel therapeutic interventions in various cancers and autoimmune diseases. Thus, the research on TNFRSF9 recombinant proteins is of significant interest in the fields of immunology and oncology, aiming to leverage the immune system's full potential in combatting malignancies and improving patient outcomes.











