Analytical Data
-
Gene name
TNFRSF13B
- Application
-
Alternative Names
TNFRSF13B；TACI；Tumor necrosis factor receptor superfamily member 13B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14836
-
Expression Region
1-160aa
-
AA Sequence
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSC KTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQC AYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPAL PGLKLSADQV
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF13B, also known as Transmembrane Activator and CAML Interactor (TACI), plays a crucial role in the immune system, particularly in B cell regulation and immunoglobulin class switching. It is a member of the tumor necrosis factor receptor (TNFR) superfamily and is expressed primarily on B cells and a subset of T cells. Mutations in the TNFRSF13B gene are associated with common variable immunodeficiency (CVID) and other immunological disorders, highlighting its importance in maintaining immune system homeostasis. The study of recombinant TNFRSF13B protein is vital for understanding its function, interactions, and involvement in immunological pathways. By producing a recombinant form of this protein, researchers can investigate its effects on B cell activation, proliferation, and differentiation, as well as its role in modulating immune responses. This knowledge can illuminate mechanisms underlying immune deficiencies and may pave the way for novel therapeutic strategies targeting TNFRSF13B-related diseases. Investigating this protein also enhances our understanding of the TNFR superfamily and its contributions to cell signaling and immune regulation.
