Analytical Data
-
Gene name
OR5U1
- Application
-
Alternative Names
OR14J1; OR5U1; Olfactory receptor 14J1; Hs6M1-28; Olfactory receptor 5U1; Olfactory receptor OR6-25
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGF5
-
Expression Region
1-321 aa
-
AA Sequence
MVNLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYF LKHLSLLDLCFISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDR YAAICQPLHYETIMDPRACRHAVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVP QMLKLACSYEFINEIALAAFTTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCL PHLFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALR KMLSKEELPQRKMCLKAMFKL
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5U1 protein, part of the olfactory receptor family, plays a critical role in the detection of odorants and is integral to the sensory perception of smell in humans. This receptor has garnered interest in recent years due to its potential implications in various physiological and pathological processes, including its involvement in neurodegenerative diseases and metabolic disorders. Given that OR5U1 is activated by specific odor molecules, understanding its structure and function can provide insights into the mechanisms of olfactory signal transduction. Furthermore, the ability to produce recombinant OR5U1 protein allows researchers to investigate its binding characteristics and functional responses in vitro, facilitating the exploration of its role in olfactory pathways. Recent advances in molecular biology techniques have enabled the expression and purification of this receptor, offering opportunities to study its pharmacological properties and interaction with various ligands. Research focused on OR5U1 could also lead to the development of new therapeutic targets in treating olfactory dysfunction and related conditions, thus highlighting the significance of this receptor in both basic and applied biomedical research. As the understanding of OR5U1 continues to evolve, it may open new avenues for neuroscience, chemosensory biology, and even the development of novel odorant-based therapies.
