Analytical Data
-
Gene name
TCEB1
- Application
-
Alternative Names
TCEB1；TCEB1；Elongin-C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15369
-
Expression Region
1-112aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDGEEKTYGGCEGPDAMYVKLISSDGHEFI VKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCEB1, also known as the T-cell epidermal growth factor receptor binding protein 1, has emerged as a significant focus of research due to its potential implications in various cellular processes and diseases. Initially studied for its role in T-cell activation and differentiation, TCEB1 has been linked to the regulation of immune responses, making it a candidate for understanding autoimmune disorders and cancer immunity. Additionally, TCEB1 is believed to interact with other proteins involved in signaling pathways, thereby influencing cell proliferation and survival. Recent studies have also suggested a potential role for TCEB1 in hematopoiesis and stem cell maintenance, highlighting its importance in developmental biology. The exploration of TCEB1 recombinant proteins aims to elucidate its functional mechanisms and interactions, paving the way for therapeutic applications. This includes harnessing TCEB1's properties for developing biomarkers or targeted therapies in oncology and immunology. Given its multifaceted roles, TCEB1 serves as a valuable model to investigate protein functions, with the potential to contribute to advancements in understanding complex biological systems and disease mechanisms. Hence, ongoing research into TCEB1 recombinant proteins is crucial for advancing our knowledge in cell biology and developing novel therapeutic strategies.
