Analytical Data
-
Gene name
OR5R1
- Application
-
Alternative Names
OR8U3; OR5R1; OR5R1P; Olfactory receptor 8U3; Olfactory receptor 5R1; Olfactory receptor OR11-185
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH85
-
Expression Region
1-324 aa
-
AA Sequence
MAEVNIIYVTVFILKGITNRPELQAPCFGVFLVIYLVTVLGNLGLITLIKIDTRLHTPMY YFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY DCYVAICSPLHYSTLMSRRVCIQLVAVPYIYSFLVALFHTVITFRLTYCGPNLINHFYCD DLPFLALSCSDTHMKEILIFAFAGFDMISSSSIVLTSYIFIIAAILRIRSTQGQHKAIST CGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDA SKKALDKGCENLQILTFLKIRKLY
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5R1, part of the olfactory receptor family, plays a significant role in the human sense of smell by mediating the detection of various odorant molecules. Research on OR5R1 has garnered attention due to its potential implications in understanding olfactory mechanisms, influence on behavior, and connection to various neurological conditions. The receptor's unique structure and binding properties may provide insights into the molecular basis of scent discrimination and the neural pathways involved in olfaction. Furthermore, studying the recombinant expression of OR5R1 can shed light on its pharmacological properties and facilitate the development of odorant-based therapies or interventions for anosmia or other olfactory disorders. With advancements in genetic and protein engineering techniques, researchers aim to produce high-yield recombinant OR5R1 proteins for detailed biochemical analyses and screenings. This research not only contributes to the fundamental understanding of olfactory receptors but also has broader implications for sensory biology and potential therapeutic applications. As the field continues to evolve, the exploration of OR5R1 offers exciting prospects for both basic science and applied health, highlighting the importance of olfactory research in the broader context of human physiology.
