Analytical Data
-
Gene name
OR51B4
- Application
-
Alternative Names
OR51B4; Olfactory receptor 51B4; Odorant receptor HOR5'beta1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5P0
-
Expression Region
1-310 aa
-
AA Sequence
MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI IRLFSGQSRA
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR51B4, a member of the olfactory receptor family, has garnered increasing attention in recent years due to its potential roles in various physiological and pathological processes. Initially identified for its involvement in olfaction, OR51B4 has been implicated in non-canonical signaling pathways and is expressed in various tissues beyond the olfactory system, suggesting functions that extend beyond traditional sensory roles. Research indicates that OR51B4 may play a role in mediating the effects of certain ligands, including potential implications in tumor biology, particularly in the context of prostate cancer, where it may influence tumor growth and metastasis. The study of OR51B4's recombinant protein provides insights into its structure-function relationships, aiding in the understanding of its signaling mechanisms and potential therapeutic targets. As a result, OR51B4 is a promising candidate for future research focused on its biological functions and therapeutic applications, especially in the fields of cancer biology and signal transduction. Understanding the dynamics of this receptor through recombinant protein studies could pave the way for novel interventions in diseases where OR51B4 is implicated.
