Analytical Data
-
Gene name
OR4X1
- Application
-
Alternative Names
OR4X1; Olfactory receptor 4X1; Olfactory receptor OR11-104
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NH49
-
Expression Region
1-305 aa
-
AA Sequence
MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFF LSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDR YVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVH PVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCAS HVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI GGKVI
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4X1, a member of the olfactory receptor (OR) family, has garnered significant interest in the field of molecular biology and neuroscience due to its potential roles in sensory perception and its implications in understanding olfactory mechanisms. The human olfactory receptor gene family is one of the largest in the genome, comprising approximately 400 functional genes, yet many of their functions remain elusive. OR4X1 specifically is known to respond to various odorant molecules, making it a key player in the olfactory signaling pathway. Research on the recombinant expression of OR4X1 protein aims to elucidate its structure-function relationship, investigate its ligand binding properties, and explore its downstream signaling mechanisms. Understanding OR4X1 at the protein level can provide insights into the broader olfactory system and its implications in behaviors such as taste and scent discrimination. Furthermore, the study of OR4X1 could have potential applications in the development of novel odorants for the food and fragrance industries or therapeutic strategies for olfactory dysfunction. By employing techniques such as protein expression and purification, as well as ligand screening assays, researchers strive to unlock the biological mysteries surrounding OR4X1 and its role within the complex network of olfactory receptors.











