Analytical Data
-
Gene name
SURF2
- Application
-
Alternative Names
SURF2；Surfeit locus Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15527
-
Expression Region
1-256aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSELPGDVRAFLREHPSLRLQTDARKV RCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPHIVPSTKN PHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQGVEYVPAC LVHRRRRREDQMDGDGPRPREAFWEPTSSDEGGAASDDSMTDLYPPELFT RKDLGSTEDGDGTDDFLTDKEDEKAKPPREKATDEGRRETTVYRGLVQKR GKKQLGSLKKKFKSHHRKPKSFSSCKQPG
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SURF2, or Surfeit 2, is a member of the Surfeit gene family, which has been implicated in various biological processes, including mitochondrial function, cellular growth, and apoptosis. The study of SURF2 and its recombinant protein has garnered attention due to its potential role in neurodegenerative diseases, such as Alzheimer's and Parkinson's disease. Research indicates that SURF2 may be involved in mitochondrial biogenesis and oxidative stress responses, thereby influencing cell viability and neuroprotection. Additionally, mutations in the SURF2 gene are associated with specific types of spinocerebellar ataxias, highlighting its significance in maintaining neuronal health. By generating and characterizing recombinant SURF2 protein, researchers aim to elucidate its functional properties and interactions within cellular pathways. Understanding the mechanisms by which SURF2 contributes to these processes could uncover new therapeutic targets for treating related disorders. Moreover, the production of recombinant SURF2 protein in model systems allows for functional assays and the exploration of its biochemical properties, paving the way for advancements in genetic and molecular medicine. As a result, this line of research holds promise not only for fundamental biological inquiry but also for the development of innovative strategies to combat neurodegenerative and mitochondrial diseases.
