Analytical Data
-
Gene name
OR4E2
- Application
-
Alternative Names
OR4E2; Olfactory receptor 4E2; Olfactory receptor OR14-42
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGC2
-
Expression Region
1-313 aa
-
AA Sequence
MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMY FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQLFFLHLFACAEIFLLIIVAY DRYVAICTPLHYPNVMNMRVCIQLVFALWLGGTVHSLGQTFLTIRLPYCGPNIIDSYFCD VPLVIKLACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRQKALSTC SAHFMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ LRQRQVFFTKSYT
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4E2 is a member of the olfactory receptor (OR) gene family, which is primarily involved in the detection of odor molecules and plays a crucial role in the sense of smell. Recent studies have shown that olfactory receptors are not only confined to the olfactory system but also exhibit diverse functions in various biological processes, including cell signaling and immune responses. OR4E2, in particular, has garnered attention due to its potential implications in neurological disorders and its ability to modulate neuronal activity. Researchers have been focused on producing recombinant OR4E2 proteins to study its structure-function relationship and to elucidate its signaling pathways. The recombinant expression of OR4E2 allows for the assessment of its ligand-binding properties and the characterization of its role in cellular responses. Furthermore, understanding OR4E2 could provide insights into the development of novel therapeutic strategies for conditions linked to its dysregulation. The ongoing research on OR4E2 highlights its significance in both olfactory and non-olfactory contexts, suggesting that this receptor may serve as a critical player in a variety of physiological processes. As the field of olfactory receptor biology expands, the full therapeutic and biological potential of proteins like OR4E2 continues to unfold, offering exciting prospects for future studies and applications.
