Analytical Data
-
Gene name
OR11G2
- Application
-
Alternative Names
OR11G2; Olfactory receptor 11G2; Olfactory receptor OR14-34
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGC1
-
Expression Region
1-345 aa
-
AA Sequence
MHFLSQNDLNINLIPHLCLHRHSVIAGAFTIHRHMKIFNSPSNSSTFTGFILLGFPCPRE GQILLFVLFTVVYLLTLMGNGSIICAVHWDQRLHAPMYILLANFSFLEICYVTSTVPSML ANFLSDTKIISFSGCFLQFYFFFSLGSTECFFLAVMAFDRYLAICRPLRYPTIMTRRLCT NLVVNCWVLGFIWFLIPIVNISQMSFCGSRIIDHFLCDPAPLLTLTCKKGPVIELVFSVL SPLPVFMLFLFIVGSYALVVRAVLRVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSP PSKNEAGKQKTVTLFYSVVTPLLNPVIYSLRNKDMRKALKKFWGT
-
Molecular Weight
38.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR11G2, a member of the olfactory receptor family, has garnered attention in the field of sensory biology due to its potential role in the detection of specific odorants. Olfactory receptors, which are predominantly expressed in the nasal epithelium, play a crucial role in the sense of smell by interacting with various volatile odor molecules. Research on OR11G2 is significant as it may contribute to understanding the mechanisms of olfactory transduction and the complex signaling pathways involved in odor perception. Furthermore, the characterization of OR11G2 as a recombinant protein could provide insights into its ligand specificity and functional dynamics. This research is particularly relevant given the broader implications for understanding olfactory receptor functioning in both humans and other species, which can have applications in fields such as neurobiology, pharmacology, and even artificial olfaction systems. With advances in recombinant protein technology, studies focusing on OR11G2 could lead to novel findings regarding its role in odor recognition and its potential involvement in various physiological processes, thereby expanding our knowledge within the domain of sensory systems.
