Analytical Data
-
Gene name
SNRPA1
- Application
-
Alternative Names
SNRPA;U1 small nuclear ribonucleoProtein A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09661
-
Expression Region
1-255aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVRDRELDLRGYK IPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKH YRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIP GRERRSGPTDDGEEEMEEDTVTNGS
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNRPA1 (Small Nuclear Ribonucleoprotein Associated Protein 1) is a critical component of the spliceosome, a large RNA-protein complex responsible for the splicing of pre-mRNA into mature mRNA. It plays a vital role in the recognition and binding of splice sites, contributing to the intricate process of gene expression regulation. Research into SNRPA1 is particularly significant due to its involvement in various cellular processes and its potential implications in diseases, including cancer and neurodegenerative disorders. Alterations in SNRPA1 expression or function can disrupt normal splicing mechanisms, leading to the production of abnormal proteins and contributing to pathological states. Consequently, studying SNRPA1 and its interactions with other splicing factors is essential for understanding the molecular mechanisms underlying these diseases. Recombinant SNRPA1 proteins are invaluable tools for dissecting its functions and interactions in vitro, providing insights into the spliceosome assembly and activity. By employing techniques such as pull-down assays, co-immunoprecipitation, and RNA-binding assays, researchers aim to elucidate the complex roles of SNRPA1 in RNA processing and its potential as a therapeutic target. Furthermore, the development of SNRPA1-based assays may facilitate the identification of small molecules or biologics that can modulate its function, presenting new avenues for therapeutic intervention in splicing-related diseases. Overall, the study of recombinant SNRPA1 proteins offers a promising platform for advancing our understanding of RNA biology and its implications for human health.











