Cat: PA2000-1249

Recombinant Human KAT2A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KAT2A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KAT2A;GCN5;GCN5L2;Histone acetyltransferase KAT2A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92830

  • Expression Region

    362-837aa

  • AA Sequence

    MLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSM GGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNE VMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPK ANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIG GICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFL TYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPY TELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGI RETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSE APDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPD SEYCRCASALEKFFYFKLKEGGLIDKDYKDDDDK

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KAT2A, also known as lysine acetyltransferase 2A, is a crucial enzyme involved in the dynamic regulation of histone acetylation, a key process in gene expression and cellular functions. Research on KAT2A has gained significant attention due to its implications in various biological processes, including differentiation, cell proliferation, and metabolism. Furthermore, aberrant KAT2A activity has been linked to several diseases, most notably cancer, where altered acetylation patterns can lead to uncontrolled cell growth and proliferation. The study of recombinant KAT2A proteins enables researchers to better understand the enzyme's structural and functional characteristics, facilitating the identification of specific substrates and the underlying mechanisms of acetylation. Advances in recombinant protein techniques have allowed for the production of KAT2A in sufficient quantities, enabling detailed biochemical assays and high-throughput screening for potential therapeutic inhibitors. As such, ongoing research focused on KAT2A is not only critical for elucidating its role in normal cellular physiology but also holds promise for developing targeted cancer therapies that modulate its activity. Understanding KAT2A's interactions and regulation could pave the way for novel strategies to manipulate acetylation pathways therapeutically.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US