Analytical Data
-
Gene name
OBSCN
- Application
-
Alternative Names
BC046431; Gm878; KIAA1556; KIAA1639; OBSCN; OBSCN_HUMAN; Obscurin; Obscurin-MLCK; Obscurin-myosin light chain kinase; Obscurin-RhoGEF; OTTMUSG00000005786; UNC89
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VST9
-
Expression Region
6521-6620 aa
-
AA Sequence
LGPRGPLGLFRPEPRGASPPGPQVRSLEGTSFLLREAPARPVGSAPWTQSFCTRIRRSADSGQSSFTTELSTQTVNFGTVGETVTLHICPDRDGDEAAQP
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OBSCN (Obscurin) is a large protein that plays a critical role in the structural integrity and function of striated muscle tissues, including skeletal and cardiac muscles. It is characterized by its diverse protein-protein interaction domains, which are essential for anchoring various signaling molecules and cytoskeletal elements at the sarcomere, the fundamental unit of muscle contraction. Recent studies have highlighted the significance of OBSCN in muscle development, mechanotransduction, and pathophysiological conditions, such as cardiomyopathies and muscular dystrophies. Moreover, OBSCN has emerged as a promising candidate in regenerative medicine and gene therapy due to its involvement in muscle regeneration and repair mechanisms. Genetic mutations or dysregulation of OBSCN expression have been linked to a variety of muscular disorders, warranting further investigation into its functional mechanisms and potential therapeutic targets. Employing advanced techniques such as CRISPR-Cas9 gene editing, high-throughput sequencing, and structural biology, researchers are striving to elucidate the multifaceted roles of OBSCN in muscle physiology and pathology, with the ultimate goal of developing innovative strategies for diagnosing and treating muscle-related diseases.
