Analytical Data
-
Gene name
dll4
- Application
-
Alternative Names
Dll4Delta Protein 4; Delta 4
-
Species
Rat
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
D3ZHH1
-
Expression Region
215-331aa
-
AA Sequence
GKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNECIPHNGCRHGTCTIP WQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPRGYTCTCLPGYTGEHC ELELSKCAS
-
Molecular Weight
14.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLL4 (Delta-like ligand 4) is a member of the Notch signaling pathway that plays a crucial role in various biological processes, particularly in vascular development, immune response, and tumor biology. Research has shown that DLL4 is involved in the regulation of endothelial cell function and angiogenesis, influencing how blood vessels form and mature. Its expression is often upregulated in various cancers, where it can promote tumor growth and metastasis by facilitating the formation of new blood vessels that supply nutrients to rapidly growing tumors. As a result, DLL4 has become a target for therapeutic strategies aiming to disrupt aberrant angiogenesis in cancer treatment. Recombinant DLL4 proteins have been generated for both experimental and therapeutic purposes, allowing researchers to study its role in cellular signaling, identify potential inhibitors, and explore its implications in combination therapies. Understanding the molecular mechanisms of DLL4 in these contexts could lead to the development of more effective treatments for cancer and other diseases involving dysfunctional angiogenesis. As such, DLL4 recombinant protein research represents a significant area of interest in molecular biology and therapeutic development, with the potential to enhance our understanding of tumor biology and lead to novel clinical interventions.
