Analytical Data
-
Gene name
SFTPD
- Application
-
Alternative Names
SFTPD;COLEC7;PSPD;SFTP4;Pulmonary surfactant-associated Protein D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35247
-
Expression Region
21–375aa
-
AA Sequence
AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF
-
Molecular Weight
35.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFTPD, or Surfactant Protein D, is a crucial component of the innate immune system, primarily produced in the lungs and involved in the defense against respiratory pathogens. As a member of the collectin family of proteins, SFTPD plays a significant role in surfactant homeostasis, promoting the clearance of microbes and modulating inflammatory responses through its ability to bind to carbohydrate structures on pathogens and host cells. Research has highlighted its involvement in various pulmonary diseases, including asthma, chronic obstructive pulmonary disease (COPD), and pulmonary infections, positioning SFTPD as a biomarker and potential therapeutic target in respiratory disorders. Studies also suggest that variations in the SFTPD gene may influence an individual’s susceptibility to lung diseases, making the protein a focal point for understanding genetic predispositions in immunological responses. Furthermore, ongoing investigations into SFTPD’s structural attributes and interactions with other molecules could provide insights into the mechanisms underpinning its protective functions in the lung, ultimately contributing to the development of novel strategies for combating respiratory illnesses. Understanding the structure-function relationship of SFTPD not only enhances our comprehension of lung immunity but also opens avenues for therapeutic interventions aimed at enhancing innate immune responses in respiratory health and disease.
