Analytical Data
-
Gene name
NR2E3
- Application
-
Alternative Names
Photoreceptor-specific nuclear receptor. Nuclear receptor subfamily 2 group E member 3. Retina-specific nuclear receptor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5X4
-
Expression Region
1-322 aa
-
AA Sequence
MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
-
Molecular Weight
61.16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR2E3 (Nuclear Receptor Subfamily 2 Group E Member 3) is a member of the nuclear receptor family of transcription factors, primarily expressed in the retina and involved in photoreceptor development and function. It plays a critical role in the regulation of gene expression in photoreceptor cells, influencing processes such as retinal degeneration and diseases like retinitis pigmentosa. Mutations in NR2E3 have been linked to various retinal disorders, making it an important target for understanding photoreceptor biology and developing potential therapeutic approaches. Researchers have aimed to produce recombinant NR2E3 protein to study its structural and functional properties, as well as to explore its interactions with other proteins and regulatory elements in the retinal signaling pathways. This recombinant protein serves as a valuable tool in elucidating the molecular mechanisms underpinning NR2E3-related retinal disorders, potentially paving the way for novel treatment strategies. The study of NR2E3 not only enhances our understanding of phototransduction but also contributes to the broader field of nuclear receptor research, with implications for other biological processes beyond vision. Consequently, the production and investigation of NR2E3 recombinant protein are critical for advancing our knowledge of retinal health and disease, and for the development of future therapeutic interventions.
