Cat: PA2000-1154

Recombinant Human HSD17b2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSD17b2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HSD17b2;EDH17B2;SDR9C2;17-beta-hydroxysteroid dehydrogenase type 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P37059

  • Expression Region

    1-387aa

  • AA Sequence

    MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLL ILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCK YLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVT KTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLEL SKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

  • Molecular Weight

    42.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HSD17B2, or 17β-hydroxysteroid dehydrogenase type 2, is an important enzyme involved in the metabolism of steroid hormones, particularly in the interconversion of estrone (E1) and estradiol (E2). This enzyme plays a crucial role in regulating estrogen levels in different tissues, influencing various physiological processes such as reproduction, development, and bone health. Dysregulation of HSD17B2 has been linked to several conditions, including hormone-dependent cancers, cardiovascular diseases, and metabolic disorders, making it a significant target for therapeutic interventions. Recent studies have focused on the recombinant expression of HSD17B2 to better understand its enzymatic functions, elucidate its role in hormonal regulation, and develop potential inhibitors or modulators. The ability to produce HSD17B2 in a recombinant system allows for detailed biochemical characterization and structural studies, paving the way for the identification of key residues involved in substrate binding and catalysis. Additionally, understanding the structural and functional properties of this enzyme can facilitate drug design efforts aimed at treating diseases associated with estrogen imbalances. Overall, research on recombinant HSD17B2 is vital for advancing our knowledge of steroid hormone metabolism and its implications in human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US