Analytical Data
-
Gene name
RWDD1
- Application
-
Alternative Names
RWDD1;DFRP2;RWD domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H446
-
Expression Region
1-243aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMTDYGEEQRNELEALESIYPDSFTVLS ENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLED NDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKK QKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAG KNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDE DDPDYNPADPESDSAD
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RWDD1 (Regulator of Wnt Signaling Pathway Domain Containing 1) is a protein that has garnered attention due to its potential role in various cellular processes, particularly in the regulation of the Wnt signaling pathway, which is crucial for cell proliferation, differentiation, and development. Research indicates that RWDD1 may be involved in cellular responses to environmental stimuli and stress, suggesting a multifunctional role in maintaining cellular homeostasis. It has been implicated in several physiological and pathological conditions, including cancer, where dysregulation of Wnt signaling is a common feature. Studies have shown that RWDD1 can interact with various signaling molecules, affecting cellular outcomes and influencing tumor progression. Furthermore, understanding the molecular mechanisms underlying the action of RWDD1 could provide insights into novel therapeutic strategies targeting Wnt-related disorders. As a result, RWDD1 has emerged as a significant subject of interest in biomedical research, prompting investigations into its structure, function, and potential applications in disease treatment. Ongoing research aims to elucidate the precise roles of RWDD1 in cellular signaling pathways and its impact on health and disease, paving the way for advancements in targeted therapies and novel drug development.
