Cat: PA2000-1113

Recombinant Human IHPK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IHPK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IHPK2;IHPK2;Inositol hexakisphosphate kinase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHH9

  • Expression Region

    1-426aa

  • AA Sequence

    MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQ FYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVD NSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEF EWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQ YKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSA VIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHE GQDAGYIFGLQSLIDIVTEISEESGEHHHHHHGGGLNDIFEAQKIEWHE

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IHPK2 (Inositol hexakisphosphate kinase 2) is a member of the inositol phosphates signaling pathway, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. Increased understanding of IHPK2 has emerged due to its potential involvement in several diseases, particularly cancers and metabolic disorders. Research has indicated that IHPK2 functions as a regulatory enzyme converting inositol hexakisphosphate (InsP6) into inositol pyrophosphates, which are important signaling molecules within the cell. This pathway’s dysregulation has been linked to altered cellular responses and pathological conditions. Given its pivotal role in cell signaling, IHPK2 is being investigated for its potential as a therapeutic target. Moreover, the study of recombinant IHPK2 proteins facilitates the understanding of their biochemical properties and interactions. Characterizing these proteins can provide insights into their enzymatic functions and regulatory mechanisms, which is essential for developing novel therapeutic approaches. As the biochemical pathways involving inositol phosphates continue to be elucidated, IHPK2’s role could become increasingly significant in drug development and disease management strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US