Analytical Data
-
Gene name
RBP5
- Application
-
Alternative Names
RGPD5;RANBP2L1;RGP5;RGP7;RANBP2-like and GRIP domain-containing Protein 5/6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82980
-
Expression Region
1-135aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPPNLTGYYRFVSQKNMEDYLQALNISLAV RKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDG RKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQV FRKVR
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBP5 (Retinol Binding Protein 5) is a significant player in the transport of retinoids, particularly retinol (vitamin A), within the body. It has gained attention in recent years due to its critical role in various biological processes, including vision, cellular differentiation, and immune function. The study of RBP5 recombinants is vital for understanding its structure-function relationships and its involvement in retinoid signaling pathways. Researchers have been particularly interested in the potential implications of RBP5 in diseases such as age-related macular degeneration and metabolic disorders. Recombinant RBP5 can be produced using various expression systems, enabling detailed studies of its biochemical properties and interactions with other proteins. Moreover, recombinant technology allows for the generation of RBP5 mutants, which can be used to elucidate specific residues important for its function and transport mechanism. By advancing our understanding of RBP5’s role at the molecular level, scientists aim to explore novel therapeutic strategies targeting retinoid metabolism and transport, potentially leading to improved treatments for conditions linked to retinoid dysregulation. Consequently, the study of RBP5 recombinant proteins is not only crucial for basic biological research but also holds promise for practical applications in medicine and drug development.
