Analytical Data
-
Gene name
NARG1
- Application
-
Alternative Names
N-alpha-acetyltransferase 15. NatA auxiliary subunit. Gastric cancer antigen Ga19. N-terminal acetyltransferase. NMDA receptor-regulated protein 1. Protein tubedown-1. Tbdn100
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXJ9
-
Expression Region
764-862 aa
-
AA Sequence
HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NARG1, or N-terminal ARF-GAP-1, is a protein that plays a crucial role in various cellular processes, including membrane trafficking and signal transduction. Recent studies have highlighted its potential impact on cellular homeostasis and its involvement in disease mechanisms, particularly in cancer and neurological disorders. The reconstitution of NARG1 as a recombinant protein has become essential for understanding its structure-function relationship and its interactions with other cellular components. By producing NARG1 in a controlled setting, researchers can investigate its biochemical properties, including its binding affinity and activity in cellular pathways. This recombinant approach also allows for the exploration of post-translational modifications, which are vital for the protein's functional regulation. Overall, the study of NARG1 as a recombinant protein is pivotal in elucidating its biological significance and therapeutic potential, paving the way for the development of novel strategies targeting its associated pathways in disease interventions.











