Cat: PA2000-1044

Recombinant mouse CCL6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCL6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCL6;C10;Scya6;C-C motif chemokine 6

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27784

  • Expression Region

    1-116aa

  • AA Sequence

    MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCL6, a member of the CC chemokine family, is a small cytokine that plays a significant role in immune response regulation, particularly in the recruitment and activation of immune cells. Recent studies have highlighted its potential involvement in various diseases, including infections, autoimmune disorders, and cancer. Given its critical functions, CCL6 has garnered attention as a promising target for therapeutic interventions. Research into recombinant CCL6 protein aims to elucidate its biological functions, signaling pathways, and interaction with specific receptors on immune cells. Furthermore, the production of recombinant CCL6 allows for systematic studies of its effects in vitro and in vivo, facilitating the exploration of its role in modulating inflammatory responses and cellular behaviors. By understanding the mechanisms underlying CCL6's effects on immune cell dynamics, researchers hope to develop novel strategies for treating diseases characterized by immune dysregulation. Moreover, the potential to utilize CCL6 in designing immunotherapeutic approaches or as a biomarker for disease progression underscores its relevance in biomedical research. As investigations continue, recombinant CCL6 protein is poised to contribute vital insights into the complex interplay of chemokines in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US