Analytical Data
-
Gene name
PSMF1
- Application
-
Alternative Names
PSMF1;Proteasome inhibitor PI31 subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92530
-
Expression Region
1-271aa
-
AA Sequence
MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
-
Molecular Weight
45.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMF1, or Proteasome Inhibitor Subunit 1, plays a critical role in the regulation of proteasome activity, a vital cellular process responsible for degrading misfolded or damaged proteins. The activity of PSMF1 is particularly important in maintaining cellular homeostasis and modulating various physiological responses, including stress responses and cell cycle regulation. Research on PSMF1 has gained momentum due to its potential implications in various diseases, notably cancer, where dysregulation of the proteasome can lead to the accumulation of oncogenic proteins. Understanding the structure and function of PSMF1 is essential for elucidating its role in proteolysis and its implications in disease progression. Recombination techniques have enabled the production of PSMF1 fusion proteins, providing valuable tools for studying its interaction with the proteasome and other cellular partners. Furthermore, insights gleaned from PSMF1 research could pave the way for novel therapeutic strategies targeting proteasome-related pathways, making it a focal point in both basic and translational research. With the ongoing exploration of post-translational modifications and the intricate network of regulatory mechanisms involving PSMF1, its study promises to enhance our understanding of proteostasis and its critical role in health and disease.











