Cat: PA2000-948DB

Recombinant Human SGCa Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SGCa

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SGCa;ADL;DAG2;Alpha-sarcoglycan

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16586

  • Expression Region

    1-387aa

  • AA Sequence

    MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPE HVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGL QVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLP STPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKV GSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLV DKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAAS REVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SGCa, or sarcoglycan alpha, is a crucial component of the dystrophin-glycoprotein complex found in skeletal and cardiac muscle cells, playing a vital role in maintaining cellular integrity and function. Mutations in the SGCA gene are associated with a group of muscular dystrophies, particularly limb-girdle muscular dystrophy type 2D (LGMD2D), which leads to progressive muscle weakness and degeneration. The study of SGCa recombinant proteins has gained significant attention as researchers strive to understand the molecular mechanisms involved in muscle cell stability and pathology. By producing and characterizing these recombinant proteins, scientists aim to elucidate the structure-function relationships of SGCa, explore potential therapeutic avenues, and assess their role in muscle regeneration and repair. Furthermore, the development of animal models expressing mutated forms of SGCa allows for in vivo studies, fostering insights into disease progression and potential interventions. As advancements in gene editing and protein engineering continue, the exploration of SGCa recombinant proteins presents opportunities for innovative treatments that could mitigate the effects of muscular dystrophies and improve the quality of life for affected individuals. Overall, the ongoing research on SGCa and its recombinant forms represents a promising frontier in understanding muscular dystrophies and developing targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US