Cat: PA2000-9437

Recombinant Human MRAP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRAP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MRAP2; C6orf117; Melanocortin-2 receptor accessory protein 2; MC2R accessory protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96G30

  • Expression Region

    1-205 aa

  • AA Sequence

    MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYI NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED DLLISEPPIVLETKPLSQTSHKDLD

  • Molecular Weight

    23.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRAP2 (melanocortin 2 receptor accessory protein 2) is a recently identified protein that plays a crucial role in the function of melanocortin receptors, particularly the melanocortin 2 receptor (MC2R) involved in adrenal steroidogenesis. The significance of MRAP2 has emerged from studies highlighting its essential role in the transport and proper functioning of MC2R on the cell surface, which directly affects the adrenal glands' ability to produce cortisol in response to adrenocorticotropic hormone (ACTH). Dysfunctional MRAP2 expression or mutations can lead to disorders, such as familial glucocorticoid deficiency (FGD), characterized by impaired adrenal response and altered steroid production. Research into MRAP2 is vital as it enhances our understanding of adrenal physiology and the molecular mechanisms governing hormone signaling pathways. Furthermore, insights gained from MRAP2 studies may pave the way for novel therapeutic strategies for related disorders, emphasizing the need for thorough investigations into its structure, function, and interactions within the melanocortin system. The exploration of MRAP2 not only contributes to endocrinology but also intersects with broader fields such as metabolic regulation and obesity research, making it a significant target for future biomedical studies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US