Cat: PA1000-2512

Recombinant Human PKR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PKR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PROKR2;GPR73L1;PKR2;Prokineticin receptor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BUB1

  • Expression Region

    1-382aa

  • AA Sequence

    MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVL PAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSV CAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQ VLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQY DNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRK MFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGN QEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLG PCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The PKR2 protein, or Protein Kinase Regulated by RNA, is a member of the adenosine monophosphate-activated protein kinase (AMPK) family and plays a crucial role in cellular responses to stress and metabolism regulation. Research into the PKR2 protein has gained momentum due to its involvement in various physiological and pathological processes, including cellular proliferation, apoptosis, and inflammation. Understanding the molecular mechanisms of PKR2 activity is particularly significant, as dysregulation can lead to metabolic disorders, cancer, and neurodegenerative diseases. Advances in recombinant protein technology have enabled the production of PKR2 in laboratory settings, allowing researchers to explore its functional properties and interactions with other cellular components. The structural elucidation of PKR2 and its binding sites can provide insights into its regulatory mechanisms and potential therapeutic targets. As a result, PKR2 has become a focal point in studies aiming to develop innovative strategies for treating diseases associated with metabolic dysregulation and cellular stress responses, highlighting its significance in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US