Analytical Data
-
Gene name
OR7D4
- Application
-
Alternative Names
OR7D4；OR7D4P；Olfactory receptor 7D4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NG98
-
Expression Region
161-197aa
-
AA Sequence
LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR7D4 is a member of the olfactory receptor family, which plays a crucial role in the detection of a variety of odorant molecules and contributes to the sensory perception of smell in humans. Recent studies have revealed that OR7D4 is specifically activated by certain pheromones, indicating its potential role in social and reproductive behaviors. This receptor is notable for its sensitivity to specific chemical stimuli, which has prompted researchers to investigate the mechanisms behind its activation and signaling pathways. The recombinant OR7D4 protein is often produced to facilitate the study of its functional properties, including its binding affinity for various ligands and its subsequent activation of intracellular signaling cascades. Understanding the structure and function of OR7D4 is vital not only for elucidating its biological significance but also for exploring potential applications in therapeutic interventions for olfactory disorders or developing novel scent-based products. Moreover, the differences in OR7D4 functionality among individuals might provide insights into the genetic basis of olfactory perception and personal odor preferences. Thus, the research on OR7D4 recombinant proteins represents a significant advancement in the fields of molecular biology, sensory neuroscience, and reproductive biology.
