Cat: PA2000-837DB

Recombinant Human BCAT2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BCAT2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BCAT2;BCATM;BCT2;ECA40;Branched-chain-amino-acid aminotransferase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15382

  • Expression Region

    28-392aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMASSSFKAADLQLEMTQKPHKKPGPG EPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLF EGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLI EVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFP GGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQV LWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLL DMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILY KDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BCAT2 (branched-chain amino acid transaminase 2) is an important enzyme involved in the metabolism of branched-chain amino acids (BCAAs) like leucine, isoleucine, and valine, which are crucial for various physiological functions, including protein synthesis and energy production. Dysregulation of BCAT2 has been implicated in several metabolic disorders and diseases, including obesity, diabetes, and certain types of cancer. Understanding the structure and function of BCAT2 is essential for elucidating its role in these diseases and developing potential therapeutic interventions. Research on the recombinant expression of BCAT2 has gained momentum due to its potential applications in biotechnology and pharmaceuticals. By producing and purifying BCAT2 as a recombinant protein, scientists aim to explore its enzymatic properties, regulatory mechanisms, and interaction with other metabolic pathways. Recombinant BCAT2 can serve as a valuable tool for studying its biological function in vitro and in vivo, as well as for screening small molecules that may modulate its activity. The insights gained from these studies could lead to novel strategies for treating metabolic disorders associated with altered BCAA metabolism, highlighting the significance of BCAT2 research in the broader context of metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US