Analytical Data
-
Gene name
MGC3101
- Application
-
Alternative Names
Dysbindin domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
D3DX86
-
Expression Region
1-156 aa
-
AA Sequence
MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
-
Molecular Weight
43.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGC3101 is a recombinant protein that has garnered attention in the field of molecular biology and biotechnology due to its potential applications in various therapeutic areas. Initially identified as a candidate for enhanced immunological responses, the MGC3101 protein has been studied for its role in modulating immune pathways, offering insights into the mechanisms underlying immune regulation. The recombinant expression systems used to produce MGC3101 facilitate large-scale production and simplify purification processes, making it a valuable tool for both basic research and clinical applications. Moreover, studies have indicated that MGC3101 may play a crucial role in the development of vaccines and therapeutic agents for infectious diseases and autoimmune disorders. As researchers continue to unravel its functional characteristics and interactions at the molecular level, MGC3101 stands poised to contribute to innovative therapeutic strategies, highlighting the significance of recombinant proteins in modern medicine.











