Analytical Data
-
Gene name
MED19
- Application
-
Alternative Names
LCMR1; Lung cancer metastasis related protein 1; Lung cancer metastasis-related protein 1; med19; MED19_HUMAN; Mediator complex subunit 19; Mediator of RNA polymerase II transcription subunit 19
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0JLT2
-
Expression Region
1-194aa
-
AA Sequence
MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED19 is a key component of the Mediator complex, which plays a crucial role in the regulation of gene expression by serving as a bridge between transcription factors and the RNA polymerase II machinery. Recent studies have highlighted the significance of MED19 in various biological processes, including cell differentiation, proliferation, and response to extracellular signals. Abnormal expression of MED19 has been implicated in several diseases, particularly cancer, where it may influence tumor progression and metastasis. Furthermore, MED19 interacts with numerous signaling pathways, suggesting its involvement in cellular mechanisms that govern homeostasis and disease. Investigating the structure, function, and regulatory mechanisms of MED19 recombinant protein can provide valuable insights into its role in transcriptional control and its potential as a therapeutic target. As researchers continue to explore the intricate dynamics of the Mediator complex, understanding MED19's contribution to gene regulation and its pathological implications will be essential for developing novel strategies for disease intervention.
