Cat: PA1000-2266

Recombinant Human OXSM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OXSM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OXSM;3-oxoacyl-[acyl-carrier-Protein] synthase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NWU1

  • Expression Region

    28-459aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSKRKFFGTVPISRLHRRVVITGIGLVTP LGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQ NFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGM IPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHA VSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARAL STNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLG YGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPL GDAAENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYY QKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATL CIAGL

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OXSM (Oxidation Resistance 1 Protein) is a relatively novel protein that plays a crucial role in cellular stress responses, particularly under oxidative stress conditions. Research into OXSM has gained momentum due to growing evidence linking oxidative stress to various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Oxidative stress occurs when there’s an imbalance between the production of reactive oxygen species (ROS) and the body’s ability to neutralize them, leading to cellular damage. OXSM is believed to enhance cellular resistance to oxidative damage by modulating antioxidant pathways and cellular repair mechanisms. Recent studies have demonstrated that OXSM expression increases in response to oxidative stress, suggesting its potential role as a protective factor in maintaining cellular homeostasis. Given its significance, the recombinant expression and characterization of OXSM have become pivotal in understanding its biochemical properties and functions. Researchers aim to produce recombinant OXSM proteins to study their structural and functional characteristics in vitro, elucidate their interaction with other cellular components, and evaluate their potential therapeutic applications in combating oxidative stress-related diseases. This research could pave the way for the development of novel antioxidant therapies targeting OXSM pathways, ultimately contributing to improved health outcomes and disease management strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US