Analytical Data
-
Gene name
CHRNa4
- Application
-
Alternative Names
CHRNa4；NACRA4；Neuronal acetylcholine receptor subunit alpha-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43681
-
Expression Region
1-627aa
-
AA Sequence
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
-
Molecular Weight
69.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Research on the recombinant CHRNA4 protein primarily focuses on its role as a subunit of the nicotinic acetylcholine receptor (nAChR), a critical component in neuromuscular transmission and neurotransmission in the central nervous system. The CHRNA4 gene encodes the alpha-4 subunit, which pairs with beta subunits to form functional receptors that mediate the effects of acetylcholine, influencing processes such as cognition, reward, and muscle contraction. Abnormalities in CHRNA4 expression or function have been linked to various neurological disorders, including schizophrenia, Alzheimer's disease, and addiction. As a result, CHRNA4 has garnered interest as a potential therapeutic target. Recombinant CHRNA4 proteins can be produced to study their structural properties, pharmacological profiles, and interaction with various ligands. This research is essential for understanding receptor function, developing novel drugs, and assessing potential treatments for diseases associated with cholinergic system dysfunction. Furthermore, investigations into the post-translational modifications and cellular trafficking of the recombinant CHRNA4 protein can provide deeper insights into its role in health and disease. Overall, the study of recombinant CHRNA4 protein represents a significant avenue for advancing our comprehension of neurobiology and addressing unmet medical needs.
