Cat: PA2000-4945

Recombinant Human SLC25A6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC25A6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC25A6;AAC3;ANT3;ADP/ATP translocase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12236

  • Expression Region

    232-272aa

  • AA Sequence

    DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK

  • Molecular Weight

    20.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC25A6, a member of the solute carrier (SLC) family of proteins, encodes for the mitochondrial carrier protein involved in the transport of various metabolites across the inner mitochondrial membrane. Its primary function is to transport carnitine and acylcarnitines, playing a crucial role in fatty acid oxidation and cellular energy metabolism. Mutations in the SLC25A6 gene have been implicated in a range of metabolic disorders, including mitochondrial diseases and certain forms of cardiomyopathy. The study of SLC25A6 recombinant proteins has become increasingly important to understand its structural and functional properties, as well as the molecular mechanisms underlying its transport activities. By producing and characterizing recombinant SLC25A6 proteins in various expression systems, researchers aim to explore the impact of specific mutations on protein function, investigate the regulatory mechanisms of transporter activity, and develop potential therapeutic strategies for diseases associated with SLC25A6 dysfunction. Additionally, the structural elucidation of SLC25A6 may provide insights into the transport mechanisms utilized by other members of the mitochondrial carrier family, enhancing our understanding of mitochondrial biology and metabolism as a whole. As mitochondrial dysfunction is linked to numerous health conditions, such as obesity, diabetes, and neurodegenerative diseases, elucidating the role of SLC25A6 offers promising avenues for developing targeted therapies and improving metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US