Analytical Data
-
Gene name
LTB4R
- Application
-
Alternative Names
LTB4R; BLT; BLT1; BLTR; CMKRL1; GPR16; P2RY7; Leukotriene B4 receptor 1; LTB4-R 1; LTB4-R1; Chemoattractant receptor-like 1; G-protein coupled receptor 16; P2Y purinoceptor 7; P2Y7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15722
-
Expression Region
1-352aa
-
AA Sequence
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
-
Molecular Weight
37.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LTB4R, or leukotriene B4 receptor, is a critical player in the inflammatory response and immune regulation. It is a G protein-coupled receptor that specifically binds leukotriene B4, a potent pro-inflammatory mediator produced during immune reactions. Understanding LTB4R's function is essential as it is implicated in various pathological conditions, including asthma, rheumatoid arthritis, and cancer. Dysregulation of LTB4R signaling can lead to chronic inflammation and contribute to disease progression. Research on recombinant LTB4R protein has gained traction to elucidate its structural and functional characteristics, paving the way for therapeutic interventions. By exploring the receptor’s binding affinity, signaling pathways, and interactions with ligands, scientists aim to develop targeted drugs that can modulate LTB4R activity. Furthermore, recombinant protein studies provide insights into the receptor's role in immune cell migration and activation, enhancing our understanding of its contribution to both innate and adaptive immunity. This research is not only vital for basic science but also holds promise for innovative treatment strategies aimed at controlling inflammatory diseases. As advancements in recombinant protein technology continue, the potential for innovative therapeutic applications targeting LTB4R expands, offering hope for improved management of immune-related disorders.
