Analytical Data
-
Gene name
HMGN2
- Application
-
Alternative Names
HMGN2；HMG17；Non-histone chromosomal Protein HMG-17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05204
-
Expression Region
1-90aa
-
AA Sequence
MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
-
Molecular Weight
36.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMGN2, a member of the high-mobility group nucleosomal binding protein family, plays a crucial role in the regulation of chromatin structure and gene expression. Its ability to modulate nucleosome dynamics makes it a significant factor in various cellular processes, including DNA repair, transcription, and cell differentiation. Due to its involvement in the architecture of chromatin, HMGN2 has been linked to key biological functions and diseases, including cancer, neurodegenerative disorders, and developmental issues. The recombinant expression of HMGN2 protein allows researchers to investigate its molecular interactions and functional roles in greater detail. By studying the properties of HMGN2 in vitro and in vivo, scientists aim to elucidate its precise mechanisms of action, explore its potential as a therapeutic target, and contribute to the broader understanding of chromatin biology. Furthermore, the recombinant protein also serves as a valuable tool in structural studies and biophysical characterization, thereby enhancing our comprehension of its binding affinities and biological implications. Overall, research on HMGN2 recombinant protein is pivotal to advancing our knowledge of epigenetic regulation and its implications in health and disease.
