Cat: PA1000-2064

Recombinant Human MYLPF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MYLPF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MYL11;HSRLC;MYLPF;Myosin regulatory light chain 11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96A32

  • Expression Region

    1-169aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEF KEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINF TVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDR FSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MYLPF (Myosin Light Chain Phosphatase) is a crucial enzyme involved in the regulation of actin-myosin interactions, playing a significant role in muscle contraction and cellular movement. Understanding the structure and function of MYLPF is vital, as dysregulation of this phosphatase is implicated in various cardiovascular diseases and muscle disorders. Recent studies have highlighted the importance of MYLPF in modulating cellular signaling pathways, particularly in the context of inflammation and cell migration. Research into MYLPF has gained momentum due to its potential therapeutic applications; for instance, targeting MYLPF activity could lead to new strategies for treating conditions such as hypertension and heart failure. Furthermore, the development of MYLPF recombinant proteins has opened avenues for in vitro studies and drug discovery, allowing researchers to dissect its regulatory mechanisms and discover small molecules that can modulate its activity. Investigating the expression patterns, post-translational modifications, and interaction networks of MYLPF is essential for developing a comprehensive understanding of its role in cellular physiology and pathophysiology. As the field progresses, elucidating the functional diversity of MYLPF across different cell types and conditions may provide novel insights into muscle biology and disease mechanisms, paving the way for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US