Analytical Data
-
Gene name
LIG3
- Application
-
Alternative Names
D11Wsu78e; DNA ligase ; DNA ligase 3; DNA ligase III; DNLI3_HUMAN; LIG 3; LIG2; LIG3; Ligase II; DNA; ATP dependent; Ligase III DNA ATP dependent; MGC78176; OTTMUSP00000000875; Polydeoxyribonucleotide synthase [ATP] 3; Polydeoxyribonucleotide synthase [ATP]; Polydeoxyribonucleotide synthase; RP23-316C11.6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49916
-
Expression Region
1-299aa
-
AA Sequence
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGGVA
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LIG3, or DNA ligase III, plays a crucial role in the DNA repair process and is essential for maintaining genomic stability. It is primarily involved in the non-homologous end joining (NHEJ) repair pathway, which is vital for repairing DNA double-strand breaks. Given its importance in cellular processes, LIG3 has garnered significant interest in cancer research and gene therapy, as its dysfunction can lead to genomic instability and tumorigenesis. Moreover, LIG3 is implicated in various cellular responses to oxidative stress and apoptosis, highlighting its potential role in disease mechanisms. Research into the biochemical properties and enzymatic activity of LIG3, particularly its ability to ligate DNA fragments, provides insights into its function in cellular repair pathways. The production of recombinant LIG3 proteins allows for detailed structural and functional studies, enabling scientists to explore the implications of LIG3 in therapeutic contexts. Understanding the structure-function relationship of LIG3 and its interactions with other proteins is essential for developing strategies to target this enzyme in cancer treatments and improving the efficacy of gene therapy techniques. Thus, the study of LIG3 recombinant proteins is fundamental for unveiling new avenues in molecular biology and therapeutic innovations.
