Analytical Data
-
Gene name
SIRPb1
- Application
-
Alternative Names
SIRPb1；Signal-regulatory Protein beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00241
-
Expression Region
1-181aa
-
AA Sequence
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESA TLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNN LDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAP TAPLLVALLLGPKLLLVVGVSAIYICWKQKA
-
Molecular Weight
43.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRPb1 (Signal Regulatory Protein beta 1) is a member of the SIRP family of immune regulatory proteins, which play a crucial role in modulating immune responses. Initially identified as a surface receptor on myeloid cells, SIRPb1 is known for its interaction with CD47, a "don't eat me" signal that inhibits phagocytosis by macrophages. The significance of SIRPb1 in immune regulation has garnered attention due to its potential implications in various diseases, including cancer, where tumors often exploit the CD47-SIRPb1 axis to evade immune surveillance. Furthermore, studies have shown that SIRPb1 can influence T cell responses and the polarization of macrophages, indicating its broader role in the immune landscape. Research on recombinant SIRPb1 proteins aims to elucidate their structural and functional characteristics, which can lead to the development of novel therapeutic strategies aimed at enhancing anti-tumor immunity or modulating immune responses in autoimmune diseases. By engineering SIRPb1 proteins for high expression and functional studies, researchers hope to better understand its interactions with ligands and downstream signaling pathways, ultimately contributing to more effective immunotherapies.
