Analytical Data
-
Gene name
SRD5a2
- Application
-
Alternative Names
SRD5a2；3-oxo-5-alpha-steroid 4-dehydrogenase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31213
-
Expression Region
28-65aa
-
AA Sequence
AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRD5A2 (steroid 5alpha-reductase type 2) is an enzyme vital in the metabolism of androgens, specifically in the conversion of testosterone to dihydrotestosterone (DHT), a more potent androgen. Research on SRD5A2 has gained significance due to its essential role in various physiological processes, including prostate development, hair growth, and reproductive health. Mutations in the SRD5A2 gene are linked to 5-alpha-reductase deficiency, a rare genetic condition leading to ambiguous genitalia and infertility in males. Moreover, aberrations in SRD5A2 activity are associated with several clinical conditions, such as androgenetic alopecia (male and female pattern baldness) and prostate cancer. The study of SRD5A2 recombinant proteins is crucial for understanding its structural and functional dynamics, which can inform therapeutic approaches. By producing SRD5A2 in a recombinant system, researchers can investigate its enzymatic properties, substrate interactions, and effects of inhibitors, paving the way for drug development targeting pathological conditions related to androgen metabolism. The insights gained from these studies not only enhance our knowledge of steroid hormone biology but also contribute to the development of novel treatments for disorders linked to SRD5A2 dysfunction.
