Analytical Data
-
Gene name
LASS5
- Application
-
Alternative Names
CERS5; LASS5; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N5B7
-
Expression Region
63-147aa
-
AA Sequence
LFERFIAKPCALRIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWR
-
Molecular Weight
35.09 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LASS5, or Longevity Assurance Homolog 5, is a member of the LASS gene family that plays a crucial role in sphingolipid metabolism and cellular signaling. Research on LASS5 has gained prominence due to its involvement in various biological processes, including cell proliferation, differentiation, and apoptosis, which are vital for maintaining cellular homeostasis. Dysregulation of LASS5 has been linked to several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. The reconstitution of LASS5 as a recombinant protein allows for detailed studies of its functional properties, enzymatic activities, and interactions within cellular pathways. Understanding the structure-function relationship of this protein is essential for uncovering its role in health and disease. Furthermore, recombinant LASS5 can be utilized in drug discovery processes, enabling the identification of small molecules that can modulate its activity. This research could pave the way for innovative therapeutic strategies aimed at targeting sphingolipid metabolism, offering new avenues for the treatment of various pathological conditions. Overall, the study of LASS5 and its associated recombinant protein holds significant promise for advancing our understanding of cellular mechanisms and developing novel therapeutic interventions.
