Cat: PA1000-2006

Recombinant Human MPST Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MPST

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MPST;TST2;3-mercaptopyruvate sulfurtransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25325

  • Expression Region

    1-297aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMASPQLCRALVSAQWVAEALRAPRAG QPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHML PGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVS LLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESR RFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSP EEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSW VEWYMRARPEDVISEGRGKTH

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of MPST (Mercaptopyruvate Sulfurtransferase) recombinant proteins has gained attention due to their significant role in sulfur metabolism and cellular antioxidant defense mechanisms. MPST is an enzyme that catalyzes the transfer of sulfur from mercaptopyruvate to various acceptors, playing an essential role in the biosynthesis of hydrogen sulfide, a crucial signaling molecule. Understanding the structure and function of MPST is vital for comprehending its involvement in various physiological processes and diseases, including neurodegeneration, cancer, and metabolic disorders. Recombinant MPST proteins are valuable tools for elucidating the enzyme's biochemical pathways and developing potential therapeutic strategies. Previous research has shown that MPST exhibits unique properties that may vary across species, emphasizing the need for detailed studies of its recombinant forms. These efforts aim to enhance our understanding of sulfur metabolism and its implications for health and disease, paving the way for innovative approaches in drug development and metabolic engineering. As the field continues to explore the multifaceted roles of sulfur-containing compounds, MPST recombinant proteins stand out as a critical focus for advancing biochemical research and therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US