Analytical Data
-
Gene name
atpD
- Application
-
Alternative Names
atpD；ATP5D；ATP synthase subunit delta. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30049
-
Expression Region
23-168aa
-
AA Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
-
Molecular Weight
31.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ATP synthase, particularly the atpD gene and its encoded protein, has garnered significant interest due to its crucial role in cellular energy metabolism across various organisms. ATP synthase is a multi-subunit enzyme that facilitates the synthesis of adenosine triphosphate (ATP), the primary energy currency of the cell, through oxidative phosphorylation or photophosphorylation. The atpD gene encodes a component of the F0 portion of ATP synthase, which is responsible for the proton translocation necessary for ATP production. Investigating the structure and function of ATP synthase, especially the atpD-encoded protein, provides insights into fundamental biochemical pathways and their regulation. Moreover, abnormalities in ATP synthase function have been linked to various diseases, including neurodegenerative disorders and mitochondrial dysfunctions. By utilizing recombinant DNA technology to express and purify the AtpD protein, researchers can study its properties, interactions, and potential roles in metabolic processes. Understanding the biophysical and molecular characteristics of the AtpD protein not only enhances our knowledge of ATP synthase function but also has potential implications in biotechnology and medicine, such as the development of novel therapeutics targeting energy metabolism. Overall, the research on atpD recombined proteins serves as a bridge connecting fundamental biology to applied scientific advancements.
