Analytical Data
-
Gene name
EPI
- Application
-
Alternative Names
EPI；LACI；TFPI1；Tissue factor pathway inhibitor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10646
-
Expression Region
29-282aa
-
AA Sequence
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
-
Molecular Weight
31.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPI recombinant proteins have gained significant attention in biomedical research due to their potential applications in diagnostics, therapeutics, and vaccine development. Epidermal growth factor receptor (EGFR) pathways, which are critical in cell signaling and proliferation, are often implicated in various cancers. The recombinant production of EPI proteins allows for the study of these pathways in detail, facilitating the understanding of tumorigenesis and the development of targeted therapies. Additionally, due to their immunogenic properties, EPI proteins can serve as promising candidates for vaccine formulation against specific diseases. The advancement of biotechnology techniques, such as genetic engineering and protein expression systems, has enabled the efficient production and purification of high-quality EPI recombinant proteins. This not only enhances their reliability for use in research but also contributes to the development of novel therapeutic strategies in personalized medicine. Overall, the exploration of EPI recombinant proteins represents a frontier in the intersection of molecular biology and clinical application, providing critical insights that could lead to better diagnostic tools and treatments for various health conditions.
