Analytical Data
-
Gene name
BACH2
- Application
-
Alternative Names
BACH2；Transcription regulator Protein BACH2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYV9
-
Expression Region
618-770aa
-
AA Sequence
PVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
-
Molecular Weight
23.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BACH2 is a transcription factor belonging to the BTB-Kelch family and plays a crucial role in immune regulation and hematopoietic cell development. Its significance has been underscored by its involvement in various biological processes, including the differentiation of T and B cells, where it regulates the balance between tolerance and immunity. Dysregulation of BACH2 has been linked to autoimmune diseases, lymphomas, and other malignancies, making it a potential target for therapeutic interventions. Recent advancements in recombinant protein technology have facilitated the production and functional characterization of BACH2, allowing researchers to explore its mechanisms of action in cellular contexts. Understanding the structural and functional properties of BACH2 is essential for elucidating its role in immune responses and developing novel strategies for treating immune-related disorders and cancers. This research is paving the way for new insights into the adaptability of the immune system and the development of precision medicine approaches in the management of autoimmune conditions and malignancies associated with BACH2 aberrations.
