Cat: PA1000-1844

Recombinant Human LSM4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LSM4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LSM4;U6 snRNA-associated Sm-like Protein LSm4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y4Z0

  • Expression Region

    1-139aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLV SCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEK KPGRQAGKQ

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The LSM4 protein, part of the LSm (like Sm) family, plays a critical role in RNA metabolism, particularly in the processes of mRNA splicing, degradation, and transport. Researching the LSM4 recombinant protein has garnered significant interest due to its essential functions in the life cycle of eukaryotic cells. LSM4 is known to form a heptameric complex with other LSm proteins, which is crucial for the assembly of RNA-processing complexes, such as the spliceosome and the telomerase complex. Understanding LSM4's interactions with RNA and other protein partners is vital for elucidating the molecular mechanisms that underlie gene expression regulation. Additionally, mutations or dysregulation of LSM4 have been implicated in various diseases, including cancer and neurodegenerative disorders, making it a potential target for therapeutic intervention. Thus, generating and characterizing recombinant LSM4 protein not only facilitates the study of its structural and functional properties but also supports the development of new strategies for disease management. The successful expression and purification of LSM4 in a laboratory setting allow researchers to perform detailed biochemical assays, structural analyses, and functional studies, ultimately contributing to a deeper understanding of RNA processing pathways and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US