Analytical Data
-
Gene name
KCNK9
- Application
-
Alternative Names
KCNK9；TASK3；Potassium channel subfamily K member 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPC2
-
Expression Region
1-374aa
-
AA Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNK9, also known as K2P9.1, is a member of the two-pore domain potassium channel family, which plays a crucial role in maintaining potassium ion homeostasis across cell membranes. Research on KCNK9 has gained prominence due to its involvement in various physiological processes, including neuronal excitability, heart rhythm regulation, and the modulation of sensory perception. Notably, mutations in the KCNK9 gene have been linked to specific disorders such as KCNK9-related developmental and epileptic encephalopathy, further emphasizing its importance in human health. Understanding the functional mechanisms of KCNK9 is essential for developing targeted therapies for these conditions. The study of recombinant KCNK9 proteins enables researchers to investigate the structure-function relationships of this channel, explore its ion conduction properties, and assess its interactions with various biomolecules. By generating and characterizing recombinant KCNK9 proteins, scientists aim to elucidate its physiological roles and potential as a therapeutic target, providing insights that could lead to novel treatments for related diseases. Consequently, KCNK9 has emerged as a compelling focus in biomedical research, with implications for both molecular genetics and clinical applications.
